SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z1H7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z1H7
Domain Number 1 Region: 43-117
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.46e-34
Family PB1 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 154-272
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-23
Family PDZ domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z1H7
Sequence length 391
Comment (tr|M3Z1H7|M3Z1H7_MUSPF) Par-6 family cell polarity regulator beta {ECO:0000313|Ensembl:ENSMPUP00000017439} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PARD6B OC=Mustelinae; Mustela.
Sequence
MGRDSRCTDKYNQMVICLLDRKAGALWDRNFRLSGPLLFCPLTFGAEFRRFSLERSKPGK
FEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEA
DYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVR
LYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVN
GIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGCVQQ
VEPSFEPEDEDSDEDDIVIEDNGMPQQIPKAVPNTESLESLTQIELNFESGQNGFIPSNE
VSLAPVASGTNTETHAPDQKLLEEDGTIITL
Download sequence
Identical sequences M3Z1H7
ENSMPUP00000017439 ENSMPUP00000017439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]