SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z1R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z1R2
Domain Number 1 Region: 217-377
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 1.22e-62
Family DNA-binding protein LAG-1 (CSL) 0.00000503
Further Details:      
 
Domain Number 2 Region: 65-219
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.71e-57
Family DNA-binding protein LAG-1 (CSL) 0.0000385
Further Details:      
 
Domain Number 3 Region: 379-490
Classification Level Classification E-value
Superfamily E set domains 1.28e-35
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z1R2
Sequence length 530
Comment (tr|M3Z1R2|M3Z1R2_MUSPF) Recombination signal binding protein for immunoglobulin kappa J region like {ECO:0000313|Ensembl:ENSMPUP00000017524} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RBPJL OC=Mustelinae; Mustela.
Sequence
MSPEGGEWGPSVAMDPVRATDPSAPPGPLTHLSLPDSSEARPQSGAHGRSLPGNWTRSSP
ERVMVLREGVRQCLQQQGAQTVRILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPVQ
GQAHQAGETGPTVCGYMGLDGTSGSAAETQKLNFEEQPDSREFGCAKTLYISDADKRKHF
RLVLRLVHRGGRELGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVS
TRYLSVEDGAFVASARQWAAFTLHLADEHCSQGDFPPREGYVRYGSLVQLVCTVTGITLP
PMIIRKVAKQCALLDVDEPISQLHKCAFQFPGDPPGGVGTYLCLATDKVVQFQASPCPKE
ANRALLNDSSCWTIIGTEAVEFSFSTSMAWTREPVTPVPLLSTLELSGGGDVATLELHGE
NFHSGLKVWFGDVEAETMYRSPRSLVCVVPDIAAFGSDWRWLRTPITVPVSLVRADGLFY
PSAFSFTYTPEYSARPGPPGAPEPAPDADALLESIHHEFTRTNFHLFIQT
Download sequence
Identical sequences M3Z1R2
ENSMPUP00000017524 XP_004746415.1.14098 ENSMPUP00000017524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]