SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z1T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z1T8
Domain Number 1 Region: 6-34,74-139
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 
Domain Number 2 Region: 145-247
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-19
Family Voltage-gated potassium channels 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z1T8
Sequence length 337
Comment (tr|M3Z1T8|M3Z1T8_MUSPF) Potassium two pore domain channel subfamily K member 15 {ECO:0000313|Ensembl:ENSMPUP00000017550} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=KCNK15 OC=Mustelinae; Mustela.
Sequence
MRKQSVRTAALILCILSYLLVGAAVFDALESEAERGRQRLLAQKRGEFRRKYGFSAEDYR
ELERLALQAEPHRAGRQWKFAGSFYFAITVITTIGYGHAAPGTDLGKVFCMFYALLGIPL
TLVTFQSLGERLNALVRRLLLAAKRCLGLPRPRVSTENMVVAGLLVCATTLALGAAAFAH
FEGWTFFHAYYYCFITLTTIGFGDFVALQSDEALQRKPPYVAFSFLYILLGLTVIGAFLN
LVVLRFLAASTDAPXXXXXXXXXXXXXXXXXXXXXXXXRGRSPPRRPIRARGSTSVSSRV
YQLQMGARDNLGFSPPSSPGAVGSGGAGRLPARRKSI
Download sequence
Identical sequences M3Z1T8
ENSMPUP00000017550 ENSMPUP00000017550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]