SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z1U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z1U5
Domain Number 1 Region: 95-343
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.78e-70
Family Nuclear receptor ligand-binding domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 26-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z1U5
Sequence length 443
Comment (tr|M3Z1U5|M3Z1U5_MUSPF) Hepatocyte nuclear factor 4 alpha {ECO:0000313|Ensembl:ENSMPUP00000017557} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=HNF4A OC=Mustelinae; Mustela.
Sequence
MSTSIWFDTSPSEGANLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKN
HMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPS
INALLQAEVLSQQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCEL
PLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSMRILDE
LVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSR
GRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSSSDAPHAHHPLHP
HLMQEHMGTNVIVANTMPSHLSNGQMCEWPRPRAQAATPETPQPSPPGGSGSEPYKLLPG
AIATIVKPPSAIPQPTITKQEVI
Download sequence
Identical sequences M3Z1U5
ENSMPUP00000017557 ENSMPUP00000017557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]