SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z224 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z224
Domain Number 1 Region: 31-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-74
Family F-box associated region, FBA 0.00000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z224
Sequence length 213
Comment (tr|M3Z224|M3Z224_MUSPF) F-box protein 27 {ECO:0000313|Ensembl:ENSMPUP00000017636} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FBXO27 OC=Mustelinae; Mustela.
Sequence
WLLILARDHGSLLPLARSCLPPTRDGRPCLLGRFCERRPIGRNLIRNPCGQEGLRKWMVQ
HGGDGWVVEVNRSTVPGAPSQTCFVSSFSWCRKKQVLDLEEEGLWPELLDSGKIEICVSD
WWGARHDSGCMYRLLVQLLDANQTVLDKFSAMPVPIQQWNNNVCFQVTHVFSNIKMGVRF
VSFEHWGQDTQFWAGHYGARVTNSSVVVRAQLS
Download sequence
Identical sequences M3Z224
ENSMPUP00000017636 ENSMPUP00000017636 XP_004776328.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]