SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z338 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z338
Domain Number 1 Region: 418-584,882-1100,1155-1208
Classification Level Classification E-value
Superfamily Ras GEF 3.27e-114
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 566-651
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-18
Family PDZ domain 0.004
Further Details:      
 
Domain Number 3 Region: 296-421
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000327
Family cAMP-binding domain 0.0008
Further Details:      
 
Domain Number 4 Region: 16-122
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000445
Family cAMP-binding domain 0.0024
Further Details:      
 
Domain Number 5 Region: 792-871
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000439
Family Ras-binding domain, RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z338
Sequence length 1677
Comment (tr|M3Z338|M3Z338_MUSPF) Rap guanine nucleotide exchange factor 2 {ECO:0000313|Ensembl:ENSMPUP00000018000} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RAPGEF2 OC=Mustelinae; Mustela.
Sequence
MASYVDNSFRQAVMKNPAERTPQDLEIVYSYLHGMEALSNLREHQLRLMCETVRYERHEA
NEVLYYPDDIGTCWYILLSGSVFIKESMFLPRSSFGKRSAGSFRRGCECIVLEPSEMIVV
DYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPVGKPPLPRGYHTECTKS
QVMENLDWKNGRGNEKEERGISKLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSS
SLSDIYQATESEAGDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPID
RTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVIL
NGSVEVTYPDGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQ
VEKNMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIED
FLLTYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEF
ENNLEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVD
SGSKAIEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRL
SEEKRNGAPHLPKIGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKIL
DKTRISILPQKPYNDIGIGQSQDDSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRIL
DFSTTPDLPDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTATPDQYSLCEVSV
TPEGVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLS
TVEVATQLSMRNFELFRNIEPTEYIDDLFKLKSKTSCANLKKFEEVINQETFWVASEILR
ETNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLF
QDLQDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKL
RMIAKEIRHVGRMASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVR
RSSFLNAKKLYEDAQMARKVKQYLSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPV
KSETSPVAPRAGSQQKAQVQAQPQQPQPQHKINQGLQVPAVSLYPSRKKVPVKDLPPFGI
NSPQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTSPQSSPRKGYTLAPSGTVD
NFSDSGHSEISSRSSIVSNSSFDSVHDERRQRHSVSIVETNLGVGRMERRTLIEPDQYSL
GSYAPMSENRGLYATATVISSPSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNIQT
IQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQSQSRESLEQAQS
RASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSMTSVTTEETKPVPMPAHIAVTS
STAKGLIVRKEGRYREPPPTPPGYIGIPITDFPEGHSHPARKPPDYNVALQRSRMVARPT
DTAGPSPVPQAHGHPAGGRPVSKPQWHKPNECDPRLAPYQSPGFSTEEDEDEQVSAV
Download sequence
Identical sequences M3Z338
XP_012903730.1.14098 ENSMPUP00000018000 ENSMPUP00000018000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]