SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z3B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3Z3B3
Domain Number - Region: 91-247
Classification Level Classification E-value
Superfamily PH domain-like 0.000307
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z3B3
Sequence length 426
Comment (tr|M3Z3B3|M3Z3B3_MUSPF) CCM2 scaffolding protein {ECO:0000313|Ensembl:ENSMPUP00000018075} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CCM2 OC=Mustelinae; Mustela.
Sequence
LCRCPPRTSRSQAAKPFPAAPPPSGPVGSALRCRPGIVSPFKRVFLKGEKSRDKKAHEKV
TERRPLHTVALSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAK
RAHQLPGHLTQEHDAVISLSAYNVKLAWRDGEDTILRVPIHDIAAVSYVRDDASHLVVLK
TAQDPGISPSQSLCAESSRGLTTVSLSESGVGPVEACCLVILATESKVAAEELCSLLGQV
FQIVYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDVKEPYETDVSAFSFPECAHV
GGVSPLSFCMQTAPHAKTASESELSATAAELLQDYMLTLRTKLSSQEIQQFAALLHDYRD
GASVHEFCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGR
YRRALS
Download sequence
Identical sequences M3Z3B3
ENSMPUP00000018075 ENSMPUP00000018075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]