SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z3B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z3B6
Domain Number 1 Region: 15-159
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.82e-71
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Z3B6
Sequence length 159
Comment (tr|M3Z3B6|M3Z3B6_MUSPF) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363019} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
GCRAADARGRLPRSFLLQLFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGG
DFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGK
HVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI
Download sequence
Identical sequences M3Z3B6
ENSMPUP00000018078 ENSMPUP00000018078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]