SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z3K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z3K7
Domain Number 1 Region: 1031-1137
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-26
Family PDZ domain 0.0000173
Further Details:      
 
Domain Number 2 Region: 339-444
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-25
Family PDZ domain 0.00000428
Further Details:      
 
Domain Number 3 Region: 815-922
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-23
Family PDZ domain 0.00000971
Further Details:      
 
Domain Number 4 Region: 668-773
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-22
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 5 Region: 58-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.61e-19
Family Nucleotide and nucleoside kinases 0.0063
Further Details:      
 
Domain Number 6 Region: 511-616
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-19
Family PDZ domain 0.0000128
Further Details:      
 
Domain Number 7 Region: 226-262
Classification Level Classification E-value
Superfamily WW domain 0.000000000000786
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 272-307
Classification Level Classification E-value
Superfamily WW domain 0.00000000195
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Z3K7
Sequence length 1190
Comment (tr|M3Z3K7|M3Z3K7_MUSPF) Membrane associated guanylate kinase, WW and PDZ domain containing 2 {ECO:0000313|Ensembl:ENSMPUP00000018169} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MAGI2 OC=Mustelinae; Mustela.
Sequence
MLCILTFIFTPCYFLFPNKQKDKCKLPARRMYKQVLLNIQKCGGISKVQNKSLRVFLLFF
NFPYSGTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYEDNYYGTPKPPAEPAP
LLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESS
EHEDKSAGASGETPSQPYPAPVYSQPEELKEQMDDTKPTKPEENEESDPLPDNWEMAYTE
KGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIYGTYYVDHINRRT
QFENPVLEAKRKLQQHNMPHTELGTKPLQAPAFREKPLFTRDASQLKGTFLSTTLKKSNM
GFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQ
SVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRT
SQSVPDITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQG
FGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPVGSE
TSLIIHRGGFFSPWKTPKPMMDRWENQGSPQTSLSAPAGPQNLPFPPALHRTSFPDSTEA
FDPRKPDPYELYEKSRAIYESRRPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVI
AMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEP
CPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKEN
EGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPH
ADIVKLIKDAGLSVTLRIIPQEELNSPASAPSSEKQSPMAQQSPLAQPSPATPNSPVAQP
APPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPSDY
RQPPLLDYRQHSPDTRQYPLADYRQPQDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVL
RLADDGPAIRNGRMRVGDQIIEINGESTRDMTHSRAIELIKSGGRRVRLLLKRGTGQVPE
YGMVPSSLSMCMKSDKHGSPYFYLLGHPKDTPWLCLRDANTPLSVYGTNG
Download sequence
Identical sequences M3Z3K7
ENSMPUP00000018169 ENSMPUP00000018169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]