SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z3N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3Z3N0
Domain Number - Region: 50-102,167-191
Classification Level Classification E-value
Superfamily BRCT domain 0.000621
Family DNA ligase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Z3N0
Sequence length 683
Comment (tr|M3Z3N0|M3Z3N0_MUSPF) DBF4 zinc finger {ECO:0000313|Ensembl:ENSMPUP00000018192} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DBF4 OC=Mustelinae; Mustela.
Sequence
MPSLLTYPLSLEMNFCSPIYACFQGGIQVKNEKNRSVKSMKTDNKPEKSKYKPLWGKIFY
IDLPSITISEKLQKDIQDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAY
TAETTSPHPSHDGSSFKSPDSVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHI
DDIRYYIEQKKKELYLLKKSSTSVRDVGKRVGTGTQKARTGRLKKPFVKVEDTSQLYRPF
YLQLNNMPFINYSIQKPSSPFDVDKPSSIQKQTQVKLRIQTDGNKRGGIPIQLQLKEKKK
KGYCECCLQKYEDLESHLLSEQHRNFAQSNHYQVVDDIVSKLIFDFVEYERDMPKKKRIK
YSIGSLSPITTSVLKKSEPKELQRISQKDFKENNVQVIEQHFLYKEIQEPEQKFLFISEC
IPHSSSELRGLNEKVTTKCSMLNTGENDIKQNFAHLPPHKNKPECILDVSEHKLMTNESD
LEELRVDHCPCRLKTSVQVSNFSMDSTASQPKQKSDTVLFPAKDLKEKDLHPIFSHDSGL
LAVNSSQEHLTIKAKTPSRSPPEEPNECDFNNMDGLPSGTIHRKVKILLGRNKKENLEPN
VELDKKRPEYLITQEGNRICSTPVQSLLDLFQTSEEKSEFLGFTSYTENSSICDVLDIWE
EENSSNLLSMFFSSPSTSTFTGF
Download sequence
Identical sequences M3Z3N0
ENSMPUP00000018192 ENSMPUP00000018192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]