SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z4H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z4H0
Domain Number 1 Region: 242-319
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.71e-22
Family Intermediate filament protein, coiled coil region 0.00069
Further Details:      
 
Domain Number 2 Region: 13-46
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000035
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Weak hits

Sequence:  M3Z4H0
Domain Number - Region: 13-126
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z4H0
Sequence length 364
Comment (tr|M3Z4H0|M3Z4H0_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000018482} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MARGLAGIGGMQGEKETMQDLNDRLASYLERVRSLEADNQRLEVRIREHLEKKGPQVRDW
GHYFKTIEELRSQIFASSVDNARIVLQIDNARLAADDFRVKYETELAMRQSVKSDIHGLR
KVIDDTNVTRLQLETEIEALKEELLFMKKNHEEEVKGLQNQIANSGLTVELDAPKSQDLS
KIMADIRAQYDELARKNREELDKYWSQQIEESTTVITTQTSEIGEAEMTLTELRRTAQSL
EINLDSMRNLKASLENSLREVETRCAMQMEQLNGVLLHLESELSQTRAEGQRQAQEYEAL
LNVKVKLEAEIATYRRLLEDGEDFNLSDALDSSSSMQTIQKTSTRKIVDGKVMSETNDTK
VLRR
Download sequence
Identical sequences M3Z4H0
ENSMPUP00000018482 ENSMPUP00000018482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]