SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z4Z7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z4Z7
Domain Number 1 Region: 287-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-56
Family SPRY domain 0.0000461
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-21
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 89-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000763
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  M3Z4Z7
Domain Number - Region: 123-211
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0915
Family HBL-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z4Z7
Sequence length 466
Comment (tr|M3Z4Z7|M3Z4Z7_MUSPF) Tripartite motif containing 60 {ECO:0000313|Ensembl:ENSMPUP00000018659} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TRIM60 OC=Mustelinae; Mustela.
Sequence
MEFVTGLVHLQEESSCPICLDYLKDPVTINCGHNFCRSCINMMWKDLDDTFPCPVCRFCF
HNKSFRSNRQLSNLTEIAKRLQVRRSKRKRQEYSMCEKHNQFLTLFCGKDLEVLCTQCSF
SVQHQKHYIYPIKKAATFHRKILEYSIEPLRDNVERVEKVLSLQTSKIVDLKRKVEDRRE
EIISEFEQIRQFLQNQQEALLRQMDDEERDILTKLNENQRTFSGHVSTLKHLLKEVECRC
VQSELELLTHIKGIYNRYQNLTYPELFVFQLKKYGFSLPPQYSGLDRIIKPFRADVMLDL
ETAHPQLIVSEDRKSVRYGNQKKHLCYNPRRFYLCPAVLGSRSFNSGRHYWEVEVGNKPK
WTLGVCRDRFPRNWRTWPVVEGGFWAIGRYIESIYVILGGKRTQLLPIVRPSKIGIFLDC
ELGEVSFYNMNDRSLLHNFNDSLIEAVCPYFYIGVDSEPLKISSVT
Download sequence
Identical sequences M3Z4Z7
ENSMPUP00000018659 ENSMPUP00000018659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]