SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z5U6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z5U6
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.13e-24
Family THAP domain 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z5U6
Sequence length 218
Comment (tr|M3Z5U6|M3Z5U6_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000018958} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWIRLLRRKNFVPGKHTFLCSKHFEAS
CFDLTGQTRRLKMDAVPTIFDFCTHLKSMKLKSRNLLKKNNSCTPTGASNLKSNISSQQV
LLEHSYAFRNPMEAKKRIIKLEKEIASLRKKMKTCLQKERRATRRWIKATCLVKNLEANN
ILPKGTSEHILPTALSSLPLEDFKILEPDQQDKTLPIL
Download sequence
Identical sequences M3Z5U6
ENSMPUP00000018958 ENSMPUP00000018958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]