SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z5Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z5Z2
Domain Number 1 Region: 89-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-53
Family SPRY domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000143
Family RING finger domain, C3HC4 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z5Z2
Sequence length 270
Comment (tr|M3Z5Z2|M3Z5Z2_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000019004} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MAQSLQEEVTCPVCLEIFFCPILLSCDHVFCFHCMQRWMLEHTDLKLTCPMCRGVTESPP
LEEWQIRALSLLIRQHSGLLMKSLHVSQELLRFREVMTLDRSTANPFLVLSDDLRNVWCG
KICHNAVEDPQRFTYLTCVLGTPYFSSGCHYWEVEVGDGKEWTLGICKESVDRKRKGGFS
VEHGFWLISLKAGTICTSSNPEIRIPASPKLSHVGIFLDVELEELKFFDTRENALIYTYS
CLSCFEPLRPFFCPELPREGDRGASLKICS
Download sequence
Identical sequences M3Z5Z2
ENSMPUP00000019004 XP_004753653.1.14098 ENSMPUP00000019004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]