SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z6B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z6B0
Domain Number 1 Region: 388-484
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.25e-24
Family PWWP domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z6B0
Sequence length 494
Comment (tr|M3Z6B0|M3Z6B0_MUSPF) PWWP domain containing 2B {ECO:0000313|Ensembl:ENSMPUP00000019123} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PWWP2B OC=Mustelinae; Mustela.
Sequence
MQLGTGPPPAPCRDPAPETSGPKPPPPLVPPFPPYFEGAPFPPPLWLRSTYRQWVPQPPP
RAIKRTRRRLSRNREPGRLALSPIRLRPRQVLCEKCKSTLSPPEAGPGPPAAPQPRRRAG
SVPGPDTEPRKLADPEGGGDSAASATRRSKREKRQEGKARVPRSPAIKISYSTPQGTGEV
VEIPSRVHGSLEPFCPSQAHGGGQDPAGPPASIPKLKLTRPGPPGTGLPPPKIRLKPRPR
GAGEREPVYRAELVEVLNGHGRGPRASSPARLGHGSAGRGPVDSSSGSSGEDEDFKPCAQ
ARRGREGLAFLATCPERGPGCAGESVWSSDSPDESRSSSSEVTFPDTCDLSSGDGASVRS
SSKHARQTVPPLTVRLHTQSVSTCVTGDGRTVAVGDIVWGKIHGFPWWPARVLDLSLSQK
EDGAPSWPEAKVSWFGSPTTSFLSTSKLSPFSEFFKLRFNRKKKGMYRKAITEAANAAQH
VAPEIRELLTQFET
Download sequence
Identical sequences M3Z6B0
XP_012911134.1.14098 ENSMPUP00000019123 ENSMPUP00000019123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]