SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z6Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z6Z3
Domain Number 1 Region: 116-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z6Z3
Sequence length 193
Comment (tr|M3Z6Z3|M3Z6Z3_MUSPF) Mesogenin 1 {ECO:0000313|Ensembl:ENSMPUP00000019356} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MSGN1 OC=Mustelinae; Mustela.
Sequence
MDNLRETFLSLEEGLGPSDSPGLLSSWDWNNRAGPFEVNQASPTQSLSPASSLGSYSSSP
RPAVAELACGHGGATSGGSGGCDGRGTGGLVEVDYNMLAFQPAYLQGAGGPKAQKGAKVR
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIRELTD
LLNGGREPRPQSA
Download sequence
Identical sequences M3Z6Z3
XP_004745893.1.14098 ENSMPUP00000019356 ENSMPUP00000019356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]