SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZCP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZCP0
Domain Number 1 Region: 79-244
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-36
Family Dual specificity phosphatase-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3ZCP0
Sequence length 754
Comment (tr|M3ZCP0|M3ZCP0_NOMLE) Protein tyrosine phosphatase domain containing 1 {ECO:0000313|Ensembl:ENSNLEP00000024477} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN=PTPDC1 OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MAAGFLPQNEQPYSTLVNNSECVANRKGNLEHPTPKYTKVGEYLRHVIPGHMWCSMACGG
RACKYENPAHWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIIN
LQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVVSLTTILDMVKVMTFA
LQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAITSVRAKRPNSIQARGQLLCVREF
TQFLIPLRNIFSCCDPKAHAVTLAQYLIRQRHLLHGYEARLLKHVPKIIHLVCKLLLDLA
ENRPVMMKDVSEGPGLSAEIEKTMSEMVTMQLDKELLRHDSDVSNSPNPTAVAADFNNRG
MIFSKEQESDPLWKRRNVECLQPLTHLKRRLSYSDSDLKRAENLLEQGETPQTVPAQVLV
GHNPRQQKLISHCYIPQSSEPDLHKEALVRSTLSFWSQSKFGGLEGLKDNGSPIFHGRTI
PKEAQQSGAFSADVSGSHSPGEPVSPSFANVHKYPNPAHQQVSHCQCKTHGVGSPGSVRQ
NSRTPRSPLDCGSSPKAQFLVEHETQDSKDLSEAASHSTLQSELSAEARRILAAKALANL
NESVEKEELKRKVEMWQKELNSRDGAWERICGERDPFILCSLMWSWVEQLKEPVITKEDV
DMLVDRRADAAEALFLLEKGQHQTILCVLHCIVNLQTIPVDVEEAFLAHAIKAFTKVNFD
SENGPTVYNTLKKIFKHTLEEKRKMTKDGPKPGL
Download sequence
Identical sequences M3ZCP0
ENSNLEP00000024477 XP_004087059.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]