SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZCV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZCV0
Domain Number 1 Region: 261-455
Classification Level Classification E-value
Superfamily Nudix 6.77e-44
Family NADH pyrophosphatase 0.0015
Further Details:      
 
Domain Number 2 Region: 19-98
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.33e-16
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZCV0
Sequence length 460
Comment (tr|M3ZCV0|M3ZCV0_XIPMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSXMAP00000000042} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MTSLQLSAKEEMLEKFLDAAARGDLSQVSTLLSNAPSLINQTGHSGWTALMLAARNGHHH
VAEKLLLLGCDKFSVNSSSQTAYDIATFWGHRHIAGLLGRAADGCGRILPGADLHPHENY
FSRETLDRQSGRRTDKVWLEAKQSDSETVYLLFSNLSPMVRTQQQDGSEAQGDMKLCLFR
FEEVKDLLLKPSSVTIFLGIEKTKSPSSSSSSEKAESLSEPPVWFAINTDEDAAALLERC
REKNCSFPRSPNRDLLKLSEEEAGVVAQARSVLAWHSRYSFCPTCGGATKMEEGGYKRSC
LNSECRSLQGVHNTCYPRVDPVVIMLVIHPDGNQCLLGRKKVFPVGMFSCLAGFVEPGET
LEEAVRRETEEESGVTVGPVQYVSCQPWPMPSNLMIGCLAVAVSTDIKVDEKEIEEARWF
PRQQVIDSLFRGDRSVFVIPPRQTIAHQLVRHWICMNSNL
Download sequence
Identical sequences M3ZCV0
ENSXMAP00000000042 ENSXMAP00000000042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]