SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZD87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZD87
Domain Number 1 Region: 96-188
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.31e-19
Family CRAL/TRIO domain 0.00079
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.7e-18
Family CRAL/TRIO N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZD87
Sequence length 188
Comment (tr|M3ZD87|M3ZD87_XIPMA) Clavesin 2 {ECO:0000313|Ensembl:ENSXMAP00000000179} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MTHLQAGLSPETLEKAKVELKENPETLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRA
RKFNHFEAFRLLAQYFEYRQQNLDMFKNLKATDPGIKQALKDGFPGVLSNLDKYGRKILV
LFAANWDQSRYTFVDILRAILLSLESMIEDPELQVNGFILIIDWSNFTFKQASKLTPSML
RLAIEGLQ
Download sequence
Identical sequences M3ZD87
XP_005817261.1.87360 ENSXMAP00000000179 ENSXMAP00000000179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]