SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZJY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZJY4
Domain Number 1 Region: 11-120
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.09e-28
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3ZJY4
Sequence length 146
Comment (tr|M3ZJY4|M3ZJY4_XIPMA) MORN repeat containing 4 {ECO:0000313|Ensembl:ENSXMAP00000002526} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MTLTRGSFTYASGEEYHGEWKEGRRHGLGQLKFQDGTCYTGQFENGLFHGSGVLLFTDGS
RYEGEFAHGKFQGSGIFSRFDGMKFEGEFKDGRVEGYGLLTFPDGTHGAPRNEGLFQNHK
LQKREKCPGVVQRAQASASSAHSLAL
Download sequence
Identical sequences M3ZJY4
XP_005801611.1.87360 ENSXMAP00000002526 ENSXMAP00000002526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]