SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZL39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3ZL39
Domain Number - Region: 37-94
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0209
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZL39
Sequence length 171
Comment (tr|M3ZL39|M3ZL39_XIPMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSXMAP00000002931} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MGVQVMFVVLFMFLATVESQKGGVSFWRDKVTLTCPQNGTWKNNMENKNALEPGETHEFH
FKGQAQYYCEYDNNEEEKIKYYFFVKGKACENCFEVDGFLFLLVILVDVIGTAVMMRIIY
ACTKRKHPNAPLQPPRTRRTRPQADQSSAYESLNPNTQSTETYSTVVHRTG
Download sequence
Identical sequences M3ZL39
ENSXMAP00000002931 ENSXMAP00000002931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]