SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZMD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZMD5
Domain Number 1 Region: 87-308
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-62
Family DBL homology domain (DH-domain) 0.0000166
Further Details:      
 
Domain Number 2 Region: 293-436
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-32
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3ZMD5
Sequence length 1355
Comment (tr|M3ZMD5|M3ZMD5_XIPMA) Pleckstrin homology and RhoGEF domain containing G1 {ECO:0000313|Ensembl:ENSXMAP00000003378} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN=PLEKHG1 OC=Poeciliinae; Xiphophorus.
Sequence
MDSSPDSVERPISYSSTSSSASSRDSHCSLGSRSTLVAAPQCNPMTPDRDSGAIRLELVP
ARQLGCEVEYEGNNGDRSRQIATEHLQPKLSPEVQEKMSPVQGPRTYVDRVVQEILDTER
TYVQDLRSIVEDYLECISNQSRLALSSEDKSSLFGNIRDIYHFNRDLLYELEKCNADPVA
IAECFVSKSEEFHIYTQYCTNYPRSVAVLTECMRNKALAKFFRERQESLRHSLPLGSYLL
KPVQRILKYHLLLHEIANHMEKDTETYEVVQEAIDTMQRVAWHINDMKRKHEHAVRLQEI
QSLLTNWKGPDLIGYGELVLEGTFRLQRAKNERTLFLFDKLLLITKKREETYTYKAHILC
CNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRMWILHLKRLILENHPAKIPAK
AKQAILEMDAIHHPGFHYSPDGEKKDSLQTKEGPTPRRGRRKGEPLSKLLKNAKQNAANN
DGEKRARESLIRDGSHHPPLLRTPRVTEEPPESPVPAVVVTETDHSVRNIWADHRARRAM
FPTRQRTMQPDDEEEDIYQMFVPTEPSAAEPEPPSERLEAPSSPRTARPCSWHVEQVPTV
QVDPPADNSRVLRRASSAGEKATEARESPGNDETGHSNLEVIHTESSSNDISGSSSAEQL
TLDDIENVYDNISYEDLRSMGLIRRDADEIQMQKDLRREQSAAKVRESLIEPDSSSESNR
SSTQDMKPYGSCDLQIVEENIYDTICFREPPSVELKGSNEGSKEKEERSSLSSEQGLTRS
LAEFVSEDSLHLRKNEESDASNPVLCSAESNYPASASKISPRDSNRADRMSEEVDELCND
LENYMKNTKKAERLPAAFPVNSHESPKKTHQPKTPHVTSAQSFTIPVINLPDCQSTVKSI
RNRLARLSSGSFRLEDDDLVELPQRTAAPREGSLKDLQSLFPGELAGLDSPLANSSLLLG
ESVDFSLELMDKTKSRVFLMARQYSQKIKKANQLLRMRSMDPGDSCSRARAERKQKDLAA
ILEEKKQGGAAIGARIAEYSQLYDQVMFKDTPLSTSQTSASSHHFHPGLPSSPSMPETSL
DDDWLHSIYSNGELVNFMSSSDGGADTQTSSSSQHRLTHTTSIPSLKTTPSAPSQRWSSC
ISAPSEEEHVYSSIKRNPSFNAPTSKSSLSDQSQSAGSLTNPQQDNHRQSGLSCNGPNVD
PSTDRPRGPSLKRAGQQSSLPDQTTLRQSDLTLHDGQQVVVLNRASALTGILNATQNYLA
NFKDNEEDDDDYVEIRSEDDSEGERDKLNQGTTRSTRNRSTVQSRSLPCTPVHSCHPLER
EHLEKYLWSEPQQNQPKIVQSLREKFQCLSSSSFA
Download sequence
Identical sequences M3ZMD5
ENSXMAP00000003378 ENSXMAP00000003378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]