SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZMV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZMV9
Domain Number 1 Region: 240-446
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-56
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 430-563
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-29
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 
Domain Number 3 Region: 619-789
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-22
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZMV9
Sequence length 812
Comment (tr|M3ZMV9|M3ZMV9_XIPMA) FYVE, RhoGEF and PH domain containing 1 {ECO:0000313|Ensembl:ENSXMAP00000003552} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
PGPKPQVPPKPPHLQQQAGAMRPRPRVPEKSLPPPPPCRPLPADPPGGAGPPPADGTASP
TCVLSLIEKFEREQIIVVPDITGGALCPRPLDPPSPRSSSPPSSASPVPPQPGGAEPPNQ
SELPSERLSLPSSQTDGKLANRDSGIDSISSPSHSEELCFAGVDDGGVAYPCSPALLPRL
SSSSSTAGEVGEGEEPRGRARRRDFSEEGDSDLEEEAELTLVLAPPKPDRQESVELSVHQ
RVFNIANELLLTETAYVSKLHLLDQVFCARLLEEARCRSSFPCDVVQGIFSNICSIYCFH
QQFLLPALQKRMEEWDSNSRIGDILQKLAPFLKMYGEYVKNFDRAMELVNIWMERSAPFK
AIVQEIQREERCGNLTLQHHMLEPVQRIPRYELLLKDYLNRLPEDAPDHRDAQKSLELIA
TAAEHSNAAIRKMERMRKLLKVYELLGGEEDIVNPTNELIKEGHILKLSNKNGTTQDRYL
ILFNDRLLYCVPKLRLIGQKYSVRARIDVDGMELKETSSVAVPSRTFLVSGKQRSLELQA
RTEEEKKDWIQAIQATIQRHEQTMESFRHLTCSLRDDESTPPHSPSCVELGKRAPTPIRE
KEVTLCMKCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLSYDNNRTNRVCVDCYVTLV
GASPTPGAMSSSSQRRRSILEKQASLAAENSVICSFLHHMEKGGGRGWQKAWFVIPENEP
LVLYVYGAPQDVKAQRSIPLIGFEVSPPESCDRLERRHAFKISQSHLTLYFSAEGEELQR
RWMDVLSRAGRGGGASHPSANRGERGGRRGGA
Download sequence
Identical sequences M3ZMV9
ENSXMAP00000003552 ENSXMAP00000003552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]