SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZMW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZMW9
Domain Number 1 Region: 5-82
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000706
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3ZMW9
Sequence length 178
Comment (tr|M3ZMW9|M3ZMW9_XIPMA) MORN repeat containing 5 {ECO:0000313|Ensembl:ENSXMAP00000003562} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MELIGNRYKGKIKNGRMEGDGEYTFPTDTKYVGEIKDGKFHGKGVLYFTNGSQYKATWEE
GIAIDGTFIFPDGLVYRNKNWDYCDGYDRRFYTERCYGFIPPGETQLTNVHPPPLIPDGC
YDCADGFYDPKIRVITTYSGEFLRNADDNEHEWIVSTCRRAWDVPLTDIPLQTSCKQI
Download sequence
Identical sequences M3ZMW9
XP_005810069.1.87360 ENSXMAP00000003562 ENSXMAP00000003562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]