SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZPN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZPN0
Domain Number 1 Region: 12-122
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.4e-25
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZPN0
Sequence length 133
Comment (tr|M3ZPN0|M3ZPN0_XIPMA) MORN repeat containing 2 {ECO:0000313|Ensembl:ENSXMAP00000004173} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MTDAAFKVSLIFPNGDKYEGECRKSESGELVRSGTGKHTSASGIIYIGEWQEDKMLGKGT
LQFPSGAVYEGEFKDNAYNGSGTYTFPDGSMYKGQFYNDRLEGEGTFTDTQGLKWTGDFH
GEAALGLKLLHNL
Download sequence
Identical sequences M3ZPN0
ENSXMAP00000004173 ENSXMAP00000004173 XP_005797255.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]