SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZRS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZRS5
Domain Number 1 Region: 835-1117
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000033
Family Rhodopsin-like 0.029
Further Details:      
 
Weak hits

Sequence:  M3ZRS5
Domain Number - Region: 175-303,362-394
Classification Level Classification E-value
Superfamily YWTD domain 0.000288
Family YWTD domain 0.026
Further Details:      
 
Domain Number - Region: 469-526
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000942
Family Hormone receptor domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZRS5
Sequence length 1483
Comment (tr|M3ZRS5|M3ZRS5_XIPMA) Adhesion G protein-coupled receptor L3 {ECO:0000313|Ensembl:ENSXMAP00000004918} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN=ADGRL3 OC=Poeciliinae; Xiphophorus.
Sequence
NLHWNKKMVNILKLLFITFLLFSAAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIE
SANYGRTDDKICDADPAQMENTRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTY
KYLEVQYECVPYIFLCPGLLRRVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRT
DTLTEYSSKEDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKS
GEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGRIVISQLNPYTLRVEG
TWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTELSKDGFLDIPFPN
SYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGALDNRLGSNTTLVRTSVNTLYSYVIMS
SNTTDMKDLFTLSVCQDQKRNIGSWPSPASNTEAFSIPSVNCFPLPNIRVEYCNPLVMMD
IAWPKTRQGTVVKMPCPSGTIGVASFMCLGPEGYWDLQGPDFSNCTSPWVNIINQKIKAG
ETAAVIARELAEQTKSNLQAGDITFTVRAMIQLVDLLDVQLRNLTPGGKDSAARSLNKLQ
KRERSCRFYVQAMVETVNNLLQPQAQAAWRELSTGEQLRAATMLLDTVEQGAFVLADNLL
KTDIVQENTDNIQLEVARMSTDGNLPDLKFPQTGGQGNSIHLSANTLKQHGRNGEIRIAF
VLYKHIGVYLSTENASMKLGSEALATNYSVIVNSAVITAAINKDSNKVYLSDPVIFTIRH
LQQSEENFNPNCSFWSYSKRTMIGYWSTQDCRLLSTNRTHTTCSCTHLTNFAVLMAHVDV
KNTDPVHEMLLDVITWVGILLSLVCLLISLFTFCFFRGLQSDRNTIHKNLCISLFIAESL
FLVGINRGDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRRYFYLV
GYGVPALIVAVSAAVDYRSYGTERICWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKM
FHHTAILKPDSGCLDNIKSWVIGAIALLCLLGLTWAFGLMYVNESTVIMAYLFTIFNSLQ
GMFIFIFHCVLQKKVRKEYGKCLRTHCCSGKSVDSSIGSVKGTASRAPGRYSSGSQSRIR
RMWNDTVRKQSESSFMTGDINSSASLNRAPGAMANHLIPNALLRPHGTNNPYNTLLGESA
VYNNPLGMYNIQEGILNNARDTSVMDTLPLNGNHGNSYSIASAEYMSDCVQIIDRGYNHK
ETTLEKKILKELTSNYIPSYLNNSHERSNEQNRNLVNKLVNNVSNGGKDSGYGMGLGVGI
GTHNDEGLGLELIREESNAPLLPQRPLPTLQAVDKRIPQENSESFFPLLNNEHNEDEGSS
PSHSHQRDSLYNSMPMLPGLPDVSAESTDGSKESGDAKSPEASLDDVYYKSMPNLGSRNH
LHQLHSYYQLGRGSSDGFVAPPNREDLSAEEAHPEPSHLVTSL
Download sequence
Identical sequences M3ZRS5
ENSXMAP00000004918 ENSXMAP00000004918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]