SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZT34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZT34
Domain Number 1 Region: 185-429
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.78e-50
Family Voltage-gated potassium channels 0.0015
Further Details:      
 
Domain Number 2 Region: 32-143
Classification Level Classification E-value
Superfamily POZ domain 3.14e-28
Family Tetramerization domain of potassium channels 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3ZT34
Sequence length 488
Comment (tr|M3ZT34|M3ZT34_XIPMA) Potassium voltage-gated channel, subfamily G, member 4a {ECO:0000313|Ensembl:ENSXMAP00000005377} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
ETETIKGVYYQRAQLIQRPEDLVSVDHALLAVINVGGNRYTFPWTTLQQFPLTRLGRLCG
CRSLEDIASVCDDYDETRKEFFFDRSPSAFKVILNFLAAGKLRLLREMCVLSLHDELNYW
GVEMAYMERCCKRKMYTRIEEVHDKERREEERRQRNAMQRLPVEETRYRKVMNWLRDMVE
NPQSGLPGKIFACLSVIMVAVTVVSLCISTMPDLREEEDRGECSSKCYNMFIIETVCVAW
FSLEFVLRFVQARSKLDFLRGPLNIIDAMAILPYYVSLVVSEEDQNRETDRPGGGKGYLD
KLGLVLRILRALRILYVMRLARHSLGLQVLGLTVRRSTREFGLLLLFLCVAVTLFSPLVH
LAESELTGPHDFSSIPASYWWAIISMTTVGYGDMVPRSIPGQVVALSSILSGILIMAFPA
TSIFHMFSRSYQELKMEHDRLFKEEVAAAAAAAATGGAAEPQGGDARSPPAGPPDQTKEL
CMEALLQE
Download sequence
Identical sequences M3ZT34
ENSXMAP00000005377 ENSXMAP00000005377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]