SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZT59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZT59
Domain Number 1 Region: 19-213
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-47
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 255-441
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.94e-25
Family BAR domain 0.0033
Further Details:      
 
Weak hits

Sequence:  M3ZT59
Domain Number - Region: 505-555
Classification Level Classification E-value
Superfamily SH3-domain 0.000266
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZT59
Sequence length 557
Comment (tr|M3ZT59|M3ZT59_XIPMA) Rho guanine nucleotide exchange factor (GEF) 38 {ECO:0000313|Ensembl:ENSXMAP00000005402} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MPLDLSALPSPVLDVEEIWSRKMSRRAKVIKELVQTEKDYLTDLELCIREVVQPLRVLQV
VDVDRLFTNMETVCEVSAALLNRLHVAMSDPDPEAVVIGEVFIQAKAALEDVYKIYCYHH
DDANMSLKAYEKEEQIKQHFTICILALKGKPNLLDMGSLLIKPVQRIMKYPLLLGELWQA
TPEDHIDYLPLQEALTAAKIINVNINEFRRRKDIVMKYKRLENDEGTLRGKLNKINIHSL
RKKGDRFAGYLKILTGVEPQVRDEVFDKEEKLFRSLEKAVRQLAKNVNCYVQYTQVRRLY
YLFQPKPLSSCIQTAPSEFSNLCKSTILPSLLFQKERMEELVLLPLTSLQGMFTAPQKLI
QKRYDKLLDYCCRLERSSSFASSSSTTVSSTASPASDAPPGPAKRDYEAINALLVDELQR
FNMAAYTILTNCVLCLVALLRGLMVCALVGAPAVHQLPVRITHTHTPAPPLSNMVEDNAQ
KLMERKVSFERQRDKKTVVQEVQHQTEEQRAWLLAEYPPNRLYQLKRKCNGCQEQDLSLL
EGELVALLEDTDPLGSS
Download sequence
Identical sequences M3ZT59
ENSXMAP00000005402 ENSXMAP00000005402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]