SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZVV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZVV1
Domain Number 1 Region: 197-278
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.19e-25
Family Thyroglobulin type-1 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 26-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-22
Family Growth factor receptor domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3ZVV1
Sequence length 281
Comment (tr|M3ZVV1|M3ZVV1_XIPMA) Insulin-like growth factor binding protein 3 {ECO:0000313|Ensembl:ENSXMAP00000006345} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MPGLCALCLAVALAALARLTGSVGPVVRCEPCDARALQQCKPLPKDCAESLREPGCGCCM
TCALGEGQACGVYTARCGSGLTCKHQPGENRPLQALLEGRGVCTSATKKLISYLKPAQKQ
ENAGNQVDDGANVTVTVVPAEETVNCGHSPGSMNTRPPLHNTLIQKAENRKTQSYKVEPV
SGGVSKDMHNFSLESKRETEYGPCRREIDSIMNSLKINNVLNPRGFRLPNCDKKGFYKKK
QCRPSKGRNRGFCWCVDKYGQPLPGYDDKQGKTKCYHLESK
Download sequence
Identical sequences M3ZVV1
ENSXMAP00000006345 XP_005802363.1.87360 ENSXMAP00000006345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]