SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZWW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZWW3
Domain Number 1 Region: 138-455
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-97
Family Protein kinases, catalytic subunit 0.0000000000629
Further Details:      
 
Domain Number 2 Region: 16-113
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-17
Family Pleckstrin-homology domain (PH domain) 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZWW3
Sequence length 473
Comment (tr|M3ZWW3|M3ZWW3_XIPMA) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS01030073} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
LNPVSILLKLCFPISGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVAEGLHKQEEERMDS
SPEPMDMEVYLTKPRQKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDIR
FPRTLGPEARSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFAGINWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTGQIITITPPGQDDSMESFDSEQRPHFPQFSYSASGTA
Download sequence
Identical sequences M3ZWW3
ENSXMAP00000006707 ENSXMAP00000006707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]