SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZYC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZYC8
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily PH domain-like 9.95e-48
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000589
Further Details:      
 
Weak hits

Sequence:  M3ZYC8
Domain Number - Region: 208-287
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.00141
Family Tubulin chaperone cofactor A 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3ZYC8
Sequence length 358
Comment (tr|M3ZYC8|M3ZYC8_XIPMA) Homer scaffolding protein 1b {ECO:0000313|Ensembl:ENSXMAP00000007222} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MGEQPIYSTRAHVFQIDPNTKKNWLPASKHAVTVSYFYDSTRNVYRIISLDGTKAIINST
ISPNMTFTKTSQKFGQWADSRANTVYGLGFSTEHHLSKFAEKFAEYKEAARLAKEKSQEK
MEMATSPSQESPAGELASPLTPLTPPMENINGTDEICDTTPNSDSRPEPAQNALAFAHSP
AMTKHWEAELEALKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECQSN
QTPVIKSQKTELNQTIEELENVLRDKEEEMEKLKEELENMNDLMEQKDTLTQKLEETELR
SRVLEEQLAGAEQRLEENQEEQENFRKSLRTLLELLDGKIFELTELRDTLARLIEEAS
Download sequence
Identical sequences M3ZYC8
XP_005804049.1.87360 ENSXMAP00000007222 ENSXMAP00000007222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]