SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3ZZ46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZZ46
Domain Number 1 Region: 25-145
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.03e-17
Family Thyroglobulin type-1 domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3ZZ46
Sequence length 311
Comment (tr|M3ZZ46|M3ZZ46_XIPMA) Epithelial cell adhesion molecule {ECO:0000313|Ensembl:ENSXMAP00000007490} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MKGFILLALAVFAALQTVESACSTCRTMKWVNCEGAAPPCTCQITLDDSNRPAIDCEKLV
SKCFLMKAEMYRRKMGQDVRTNIGGKPHEDAIMDNDGIYNPDCENDGKFKAKQCNNTEEC
WCVNSAGVRRTDKGDKNMNCSKLVETYMIRLELTHKELESNNKVNVQALENSVKNLLQTR
YQVDGSLVKNVQYDPDGRYIVIDIEKEKGDRTTNLGNMAYYMEKDLKVSPLFNNQTKVQL
NGGSQKLDLNKIVVYYVDEERPTITMQYLTGGIIAVIVVVVLVVVLGLLALFFVNRKRQQ
RYSKTQQREQS
Download sequence
Identical sequences M3ZZ46
ENSXMAP00000007490 ENSXMAP00000007490 XP_005795218.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]