SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4A019 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4A019
Domain Number 1 Region: 175-264
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.28e-23
Family Thyroglobulin type-1 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4A019
Sequence length 276
Comment (tr|M4A019|M4A019_XIPMA) Insulin-like growth factor binding protein 2a {ECO:0000313|Ensembl:ENSXMAP00000007813} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
TKARTPPTMLWFTGCSLLLLSAPFAGASLSEMVFRCPGCTAERHVVLEKATADLSFLILL
PSRGCSAFCYKKKFRLCHLWPTCHLGIRHGSDTESSLATEQMRMDYSKCARVLMCRVKGE
ALELQPDLDASEIPAARKPSKDAAWLGPKESAVRQHRQEMKTKMKTNKVEEVRPTRPKQT
QCQQELDQVLERISKMPFRDNRGPLEDLYALHIPNCDKRGQYNPKQCKMSLHGQRGECWC
VDPHTGQRILSAPAVRGDPNCSQYLSELELPDATQI
Download sequence
Identical sequences M4A019
ENSXMAP00000007813 ENSXMAP00000007813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]