SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4A3W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4A3W3
Domain Number 1 Region: 290-408
Classification Level Classification E-value
Superfamily EF-hand 2.33e-31
Family Osteonectin 0.0089
Further Details:      
 
Domain Number 2 Region: 60-129
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.97e-21
Family Thyroglobulin type-1 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 198-268
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.67e-19
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 4 Region: 13-58
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000018
Family Ovomucoid domain III-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4A3W3
Sequence length 430
Comment (tr|M4A3W3|M4A3W3_XIPMA) SPARC related modular calcium binding 1 {ECO:0000313|Ensembl:ENSXMAP00000009157} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
GKQWLIGERDNHCGSVCLRTLGKPVCGSDGRTYETNCELQRARCRDKTLTMAHRGRCREA
GQSKCHVERNQALEQARRPQESTFVPECNEDGTFAQVQCHTLTGYCWCVTSDGKPVSGSS
VHNRKPVCSDASGSVTDRPPGPPNAGRKDDGSKPTPTMETHIPPEGEEITAPTLWIKHLG
YMENKQNSSTSRRQEKVPSCDQERQNALNEAQQSSRESIIIPDCGSGGLYKPVQCHQHTG
YCWCVLVDTGRPIPGTSTFKRYKTPECDADARSYVADPEDPFHPRVLFVPGCPEGKKGEF
ITSLLDALTTDMVQAINSPAPSGGGRFVEPDPSHTLEERVVHWYFAQLDNNGSNDINKKE
LKPFKRYLKKKAKPKKCARKFTDYCDLNKDKAISLQELKGCLGVSKDGSPLTSGSQGTRQ
GTKLFTGSLT
Download sequence
Identical sequences M4A3W3
ENSXMAP00000009157 ENSXMAP00000009157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]