SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4A6K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4A6K6
Domain Number 1 Region: 205-452
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-57
Family Voltage-gated potassium channels 0.00079
Further Details:      
 
Domain Number 2 Region: 36-144
Classification Level Classification E-value
Superfamily POZ domain 3.14e-31
Family Tetramerization domain of potassium channels 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4A6K6
Sequence length 595
Comment (tr|M4A6K6|M4A6K6_XIPMA) Potassium voltage-gated channel, Shaw-related subfamily, member 4 {ECO:0000313|Ensembl:ENSXMAP00000010100} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MISSVCVSTYRGRKSGNKPPSKSCLKEEMARGEDSEKIIINVGGTRHETYKSTLRTLPGT
RLAWLAEPDSQGCCSESDAELPSVSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFE
EELAFWGIDDTDVEPCCWMTYRQHRDAEEALEIFEPPDPEDTDDDRDTPRRFGIEDRSDR
SRGCWEVWRPKLWALFDDPYTSKAARGVAIISLFFILVSITTFCLETHQAFDVKQNITEL
VTEGNITRMEIRDETVTNPKLIMVEGICVVWFTFEFLVRIICCPNKLAFIKNTLNIIDFV
AILPFYLEMSLRGLSSKAASNVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNE
FLLLVIFLALGVLIFATMIYYAERIGVTYNPKIENHFKNIPISFWWAVVTMTTLGYGDMY
PQTWLGMMVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHTQNPDAPT
DSASFVKSETNSHIDSTQSDTCPLAAEESSSRNRSDSKQNGDANVAHSDEEGCSLTQPLS
PSEKWSLHCSRGRGKNKEGTCFILTSGEPSIHVEGCRDILGTTGNYTQPEVTTLT
Download sequence
Identical sequences M4A6K6
ENSXMAP00000010100 ENSXMAP00000010100 XP_014325136.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]