SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4A7C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4A7C8
Domain Number 1 Region: 146-326
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.7e-47
Family CRAL/TRIO domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 67-141
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000772
Family CRAL/TRIO N-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4A7C8
Sequence length 356
Comment (tr|M4A7C8|M4A7C8_XIPMA) Tocopherol (alpha) transfer protein {ECO:0000313|Ensembl:ENSXMAP00000010372} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MYTFKVLTEVTKQPTFTPLYSKLQVHSDSQSLPSGSRTGPSCPVASSVRRRPAAESRPEC
DMNGSQITELPDDSEQLRPHVVSLRRAALQAYDLPAVGTFSDGFLIRFLRARDFDLTLSL
KLLLNYLHWRRESPEISTCLSPSSVFGLLKTSYHAVLPQRDHAGSRVLIYRIGQWNPKDW
SAFQVFRVSLMTSEIISRETETQRRGLKVIFDLKGWSLGHALQINPSLARKISSVLSDSF
PLKVRGIHLVNEPIFFRPVFTMIRPFLPDKIKQRVHMHGTDFHRTLSDLFSPDVLPPEYG
GEGLGIEEVCQAWTQELFQSENLLKQIASHPTGDLSTNTGDTLISEENETMTLTEG
Download sequence
Identical sequences M4A7C8
ENSXMAP00000010372 ENSXMAP00000010372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]