SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4A7H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4A7H3
Domain Number 1 Region: 193-424
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-60
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 36-145
Classification Level Classification E-value
Superfamily POZ domain 3.4e-31
Family Tetramerization domain of potassium channels 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4A7H3
Sequence length 788
Comment (tr|M4A7H3|M4A7H3_XIPMA) Potassium voltage-gated channel, Shab-related subfamily, member 2 {ECO:0000313|Ensembl:ENSXMAP00000010417} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MAEKLGSAGPKPNNVRTAPPLPPEPIEIIRTKARSRRVRLNVGGLNHEVLWRTLDRLPRT
RLGKLRDCNTHESLMEICDDYSLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSF
GQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEGEFDNTCCPEKRRK
LWDLLEKPSSSVAAKILAIISILFIVLSTIALSLNTLPELQVMDEFGQANDNPQLAHVEA
VCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRR
VVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEK
DEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVN
NFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMEILDVVVEKGEDKTSL
DNHLTPSRLGSSTRHATSESSLRSPDKRNPEHRISRTPQHLSVQKLEEMYNQMTKSQSFT
NLSSMSTLSTTMTVPGSPKKSLSPDSTLKEEVLLEAGDDYGLYEIRHTTIPPLLNFSHLR
CTGNDFYESHNPCDGSDLHTEEGKRFNSAAEITQSSPSENNPPKIKGLKTNFSKSSNEGP
ITPPSTTSPGDISSSVLGDETPTGETSPLIPSSEELIPVTLEGPCSFSPKKLLVDTPPGD
EDQSTDNHEEKQLMEEAGAAVAPLSPKTAAQNCSQGNNPGGHKVENHIFTSSDIHLIPGD
GSLSPTCE
Download sequence
Identical sequences M4A7H3
ENSXMAP00000010417 ENSXMAP00000010417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]