SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4A8V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4A8V9
Domain Number 1 Region: 151-294
Classification Level Classification E-value
Superfamily PH domain-like 7.62e-41
Family Third domain of FERM 0.00027
Further Details:      
 
Domain Number 2 Region: 459-671
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-39
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 
Domain Number 3 Region: 799-948
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-31
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 4 Region: 655-778
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 5 Region: 51-153
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-26
Family Second domain of FERM 0.00018
Further Details:      
 
Domain Number 6 Region: 1-50
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000413
Family First domain of FERM 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4A8V9
Sequence length 965
Comment (tr|M4A8V9|M4A8V9_XIPMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSXMAP00000010903} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MNLIEGDYFGLEFQNHKSMMVWLDHIKPIIKQLRRPKNTTLRFSVKFFPPDHAQLLEELT
RYLFALQVKQDLSSGRMMCNDTSAALMVSHIIQSEIGDFDESHCRSHLLNNNYIPDQMPL
IDKIMEFHSKHIGQSPAESDFQLLEVARKLDFYGTRLHPAKDREGSKLSLAVAHTGVLVF
QTHTRINAFNWSKIRKLSFKRKRFLIKLRPDLNSSCQDTLEFLMASRDCCKVFWKICVEY
HAFFRLFEEPKPKPKPMLFTRGSSFRFSGRTQKQVIDYVRESEFKKIPFERKHSRIRYSS
RVQHNSRLSPLPSPRHHEVPSESGVPEDFSSSSPPRRHWKESVLVSAEDPAASRTSKMSP
NHQRNGHEDRKESVSKPEESRGSTRQMSPEHPSKGVAPHSPPPSGHPHGMVNGQKSLELC
SNSLDGRQPSPLTSPLLNDACSIRTDDEDEVRRKRFPTDRAYFIAKELLTTERTYLKDLE
VVTVSFQSVVEQDEATPDSLKNTILSTFEPLHKFHTGFLREVEQRLAMWEGRSNAHIKGD
YQRIGDVMLNNLQALKPLTTNMHKHSDILLELEKACKASRRMENLCRDFELQKVCYIPLN
VFVLRPLHRLIHYKQILERLCKHYPATHEDFRDCRAALADVSEVVDQLQGSLLKMENLQK
LLELQKDLLGVDNLVVSGREFIRLGCLSKLSGKGLQQRMFFLFNDVILYTSRGMTPTNQF
KVHGQLPLRDMTIRESEEEWGVPHAFTLVGQGQSVVVAASSLTEMEKWMQDIKMAIEVAK
TSNGPTSDALTCTLTDNKCPEDSTAEAESEDDTTALHTSLEKPTPHRGNTMVHVCWHRNT
SVSMVDFSVAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKSHQDDYPLASLPLLG
YSVTVPTENENIHKDYVFKLHFKSHVYYFRSESEYTFERWMEVIRSATVSSSQARLLNSK
YPHPH
Download sequence
Identical sequences M4A8V9
ENSXMAP00000010903 ENSXMAP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]