SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4A8W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4A8W5
Domain Number 1 Region: 213-241,268-468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-55
Family Voltage-gated potassium channels 0.0007
Further Details:      
 
Domain Number 2 Region: 87-184
Classification Level Classification E-value
Superfamily POZ domain 1.6e-25
Family Tetramerization domain of potassium channels 0.00000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4A8W5
Sequence length 519
Comment (tr|M4A8W5|M4A8W5_XIPMA) Potassium voltage-gated channel subfamily A member 10 {ECO:0000313|Ensembl:ENSXMAP00000010909} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN=KCNA10 OC=Poeciliinae; Xiphophorus.
Sequence
LASKQAMEVPLVNFENMDDVGINEGLSPSTPPTLTSKANSSSGSLISSLKLLANSESPTD
SVFSKMLKDYYENEDLFEKHCLEEKDEKVVINISGLMFETQLSTLSKFPETLLGDPMKRL
QYFDPMKNEYFFDRNRPSFDGILYYYQSGGRLRRPANVPLDIFANEIVFYELGHEAMEQF
REDEGFIKEPEVLLPTNELKKQFWLLFEYPESSSAARSVALVSVFVIVISIFIFCLETLP
EFRDDSDFPPGFIQMINGTASYPAPKTVWTYLTDPFFIVETICIIWFCFELGVRFVVCPS
KSDFFNNIMNIIDIVSIIPYFVTLGTELATKPDEDLNAGQNMSLAILRIIRLVRVFRIFK
LSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAIYFAEVDEPQTQFVSIPDGFW
WAVVSMTTVGYGDMCPITMGGKMVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEK
QVMDAAAEAAQKMSAANKYGSTLSLNKSNGTFQNEKNGM
Download sequence
Identical sequences M4A8W5
ENSXMAP00000010909 ENSXMAP00000010909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]