SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AAB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AAB5
Domain Number 1 Region: 689-878
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-52
Family DBL homology domain (DH-domain) 0.0000000199
Further Details:      
 
Domain Number 2 Region: 883-1021
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-37
Family Pleckstrin-homology domain (PH domain) 0.000000509
Further Details:      
 
Domain Number 3 Region: 385-521
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000137
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 4 Region: 1190-1237
Classification Level Classification E-value
Superfamily SH3-domain 0.000000227
Family SH3-domain 0.0019
Further Details:      
 
Weak hits

Sequence:  M4AAB5
Domain Number - Region: 210-293
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000131
Family CRAL/TRIO domain 0.01
Further Details:      
 
Domain Number - Region: 529-623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4AAB5
Sequence length 1274
Comment (tr|M4AAB5|M4AAB5_XIPMA) MCF.2 cell line derived transforming sequence like {ECO:0000313|Ensembl:ENSXMAP00000011409} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN=MCF2L OC=Poeciliinae; Xiphophorus.
Sequence
MLLWMKTEEMALGELLERLRSVTQTIGWTEFLSTGKEQREGVPGGDGKRQADGEEIWADR
VLVDSGENERMMEEKTDNRTEEEMDEDLHTRLNPKDECGCRHVRISLEEVERFYKFSCRC
HWLCDEIMQLDTNPPRAADITPDLRKQFAFLSGGRGDNGSPIIVFPEFPAFGEITDREFH
NVLTYLTSVPSLSSTDVGFILVIDRRQDRWAAVKGTLLRIAGSFPGNLQLVLVLRPTTLL
QRTLSDILFKFNKDEFKMKVPVIMLSSVSELHSYIDRTQLTRELGGTQDYCHEKWISHRT
AIEGFALMVKRTAQTLQSFGTELAETELPNEIKTTTILLSTHTSKRDKMKEDILVALDQG
SRLLESINEPVIRDPDHNMNQDELENLATVQRLLSQLDETERAFEEFWVRHQTKLEQCLQ
LRHFEHNYREVRGLLDSLSEKLVTFSEVGISPAHADHIFCELTSFEERVCEVLDRASALS
HEGDELIQKSHYAEDSIQPKCSELRAVSESLSCNLRTKKDYLLKAIELHHRLERASKWVD
DGIYLLASQPVDKCQSHEGAELALQELERYLDNAGQNQLTDLGAIWKEYEEVLNQQFREQ
VEKVYQKQASMQEMFDKRKISLKKLAAKQTRPVQPVAPRPEAFIKSPLSSPAHKAQLEKN
SESNLSCEKRNGQLQNEDGGSRHASQSEEEENLAVLRRHVMNELLETERAYVEELLCVLQ
GYASEMENPTMSHLIPAPLQNKKEVLFGNMPEIYHFHKRTFLRELELYTDCPELVGRCFL
ERMTDLQIYEKYCHNKPRSESLWRQCSDCAFFQECQKKLEHKLGLDSYLLKPVQRITKYQ
LLLKEMLKYSKGCDGADDLQEALTSILGILKAVNDSMHLIAITGFEGNMSELGKLLMQGS
FSVWTEHKKGHAKVKDLARFKPMQRHLFLHEKALLFCKRREENGEGYEKAPSYSFKQSLS
MNAVGFTENAKGDNKKFEIWSSSREEVYIVQAPTAEVKTTWVNEIRKVLTTQLEACREAS
QQRAPDQVFQFPPVPTGTVSLSPLKTSQKVKKGEEKKAEPCSPDVASTCSPKLTVKDEAV
TSPTSDRAAVAKKRFTLQGFSNLKTQKGSSTSPDHNTKRQSDPTPFGFKGPPPLHLTRAR
WFSTSSLLQTKWRGWNKTSLSLDEHDGYSSAEEPLNSDPEDENHKKLCAGKYTVMADYEN
GAAEELLVKSGDMVQLVKEGDDGQWFVRNLNTSKESWMAAANLMTLMEKSKSCQSLSSSE
GSGNLSTSSSCSET
Download sequence
Identical sequences M4AAB5
ENSXMAP00000011409 ENSXMAP00000011409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]