SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AAU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AAU3
Domain Number 1 Region: 251-490
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-59
Family DBL homology domain (DH-domain) 0.0000298
Further Details:      
 
Domain Number 2 Region: 487-612
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-35
Family Pleckstrin-homology domain (PH domain) 0.00073
Further Details:      
 
Domain Number 3 Region: 54-115
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000544
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4AAU3
Sequence length 958
Comment (tr|M4AAU3|M4AAU3_XIPMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSXMAP00000011587} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
GPLRSDTEGRNTTKVSRTFSYLKNKIHIAVKKKKKERERKEKDRDKRDKDKESKEKDKKA
VNGHLYTPVSSNQSLQCSQCNKAFNGKEAFCCTYCNASVHKGCRDSMPVCANVKMKLPKQ
QFAVPDSSAPCSVPGVTMRNKAGGTRDRPRSAILSPEDNLPLMVPGSRRHTSIMTFPGNN
LSKSLSISNIAGPFDDIPIKGLRYLSQSTDSLNRTNQVTESMESLTDEGTEMMDAQLLGE
FEANAKEFEADSWSLCVEQQYLQQQNKELVKRQDVIYELMQTEMHHIRTLRIMSEVYSKG
LQKEVPLEQHTAEKMFPALDDLLDLHSQLLQRLLDRKKESQLEGGGSESGFVINRIGDIL
VSQFSGSNGESMKRVYGKFCSRHNEAVNVYKDLMNKNKNFKTFIKKKRSSSTVRRLDVPE
CILLVTQRITKYPVLIQRMLSHTTDTDEDYVDLSEAIRLVKEVIAAVDSKVNEHEKKRRL
KEFHSRMDSKSIMILKSGQFFAREDLLRRKLIHDGALQLKNTQGRLKDVQALLLSDVLVF
LQEKDQKYVFAMLDQRSTVISLQKLIVREVANKERGLFLITAGTEKPEMMEVLASSKEER
NTWMQLIQTAMQSMEKDEDEGIPSETEDDKRQLESKAKEMRDMLKQKDTEIMSLLEEKVR
LFREMWEGLSPGEEACRQVEPFFRSACSQEPPQGASIMKDALQEAVETLQALVNGSLGGA
MASVHEGGASGPVCLPRRAETFGGFDSHQMHGGKSGDRDESEDAVGDLRRTESDSVLKKG
GNANLLQLLKRNSEQVLHSVSNLHLLLSTLQQAVVVQQDSYIEDQRQALSERSSSCSSLS
RQSSRPSSLIEQEKQRSLEKQRQELASLQRQQAALAEERRRREREWELREQQLSDRESTV
HLQEEEVQKQHKQLDEERKELQSKKEEYQRDLERLRDAQRKLEREREAVQRQIHRMEE
Download sequence
Identical sequences M4AAU3
ENSXMAP00000011587 ENSXMAP00000011587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]