SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AC90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AC90
Domain Number 1 Region: 103-404,444-718
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.09e-125
Family Acetyl-CoA synthetase-like 0.0000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4AC90
Sequence length 722
Comment (tr|M4AC90|M4AC90_XIPMA) Acyl-CoA synthetase long chain family member 6 {ECO:0000313|Ensembl:ENSXMAP00000012084} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN=ACSL6 OC=Poeciliinae; Xiphophorus.
Sequence
MLAFVLVSGSLWIILELSSTLMEKMQVQDMMSGLRIPEMDELGQFFRSLPTSTLVGIGAL
TAVLAYWFATRPRPIKPPCSLLHQSEEVPHEDGGRRSMMGDPTRLLTHYHDDARTMYEVF
QRGLHISGDGPCLGSRLPNQPYKWMSYKEVSARAEHLGSGLLHQGCQPNPDQFIGVFAQN
RPEWIISELACYTYSMVVVPLYDTLGADAIRFIINTADISTVICDKVKKAQVLLANVERK
ATPKLQRIILMDAFDSELETRGKACGVHVQGLQEVEALGREYYRTPIPPAPDDLSIVCFT
SGTTGNPKGVMLTHGNVVADFAGFLKVTDTVIFPNQDDCLISFLPLAHMFERLIENVVYC
HGGRIGFYQGDIRLLPDDMKALRPTIFPVVPRLLNRMYDKIFSQANTPVKRWLLNFAAKK
KGAEVSRGVIRSDSIWDKIFFSKIQASLGGRLRMIITGAAPTSPNVLSFLRAALGCQVYE
AYGQTECTAGCTYTTPGDWTSGHVGAPLPCNLIKLVDVPEKNYFASKGEGEVCVKGPNVF
KGYLKDPERTAETLDADGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYISPEKIENI
YIRSEPVAQLYVHGDSLQSCLVGIVVPDPEVMPEWAKKKGILGTYKDLCKNTELKKAILE
DLVRLGKANGLLSFEQVKNIYIHNEMFSIENGLLTPTLKAKRPELKEFFKNKIDDLYSSI
SM
Download sequence
Identical sequences M4AC90
ENSXMAP00000012084 ENSXMAP00000012084 XP_005808818.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]