SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4ACY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4ACY0
Domain Number 1 Region: 498-687
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-54
Family DBL homology domain (DH-domain) 0.0000000197
Further Details:      
 
Domain Number 2 Region: 692-831
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-38
Family Pleckstrin-homology domain (PH domain) 0.000000502
Further Details:      
 
Domain Number 3 Region: 198-332
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000304
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 1002-1055
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000374
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 5 Region: 13-106
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000615
Family CRAL/TRIO domain 0.0066
Further Details:      
 
Weak hits

Sequence:  M4ACY0
Domain Number - Region: 340-436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000432
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4ACY0
Sequence length 1100
Comment (tr|M4ACY0|M4ACY0_XIPMA) Mcf.2 cell line derived transforming sequence-like a {ECO:0000313|Ensembl:ENSXMAP00000012324} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MPLSCSVAASGEGFILIIDRRLDRWAAVRATLLRIAGSFPGNLHLVLVLRPTTLFQRTLS
DFLFKFNRDEFKMKVVMLSTVTELHAYIDPGQLTTELGGTQEYCHDSWITHRTAIEAFAL
MVKTMAQTLQAFGTELAETELPNDAEATVDLLHKHTLQKDTMKEDLKVALSQGRRLLACI
NEPLQTDPDYNMTQDEMENLATVQRLLGQLDETQTAFDDFWERHRTKLEQCLQLRHFEKH
FREVRPQLDVMFERLSGFSEVSISPAHAEHVLRELSSHEEKACELMDLALSLASEGDSLI
ENSHYAEDSIRPKCGELRGVCEEIGSTLRGKKGLLLRARELHHALEKASQWCEDGILLLA
NQPVDRCQSQDGAEAALQELERYLDTAALHTISDRGAICCQYEAVLNPQLRDHVDKVFQK
QSSVQEMFEKRRVSLKKLAAKQTRPVQPVAPRPEVKSPLSSPNPERKERRYSADSALCKK
DESPVHNGGTRHASLSEEEENLAVLRRHVMNELLETERAYVEELLCVLEGYAAEMDNPAM
AHLIPSTLQSKKDILFGNMPEIYQFHKRTFLKDLEAYTDCPELVGRCFLERMKDLQIYEA
YCQNKPRSESLWRQCSDCAFFQECQKKLEHKLGLDSYLLKPVQRITKYQLLLKELLKYSK
GCDGADDLQEALSSILGILKAVNDSMHLIAITGYEGNLSDLGRLMMQGSFSVWTEHKKGH
AKVKDLARFKPMQRHLFLHEKALLFCKKREENGEGYEKAPSYSFKHSLSMSAVGITENAK
GDNKKFEIWCNSREEVFIVQAPTAEIKTAWVNEIRKVLTQQLKACRDATQQKSSDSPNPT
SNNSSISLSPFRSSAQKNQRKQDEKKVEPNPTSEANSCPSPKHKDEAVTSPTTDRSSVAK
KRFTLQGFSNLKSPKGSALSPELSSKRHSVKSDPTPFGFKEPASRSTLSRVKWMSTSNLL
QSKRRGWNKPSLSVDASEENDGFSSGEDPMTSDIEDEVVKKLAPGKYSVVADCEKAGPQE
LSVKSGDMVQLIREGEDGQWFVKNLRSGKEGWVAAANLLSLISESKSSQSLSSSDGSVSG
NLSTSSSCSETYTSFSDIKP
Download sequence
Identical sequences M4ACY0
ENSXMAP00000012324 ENSXMAP00000012324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]