SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4ADD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4ADD6
Domain Number 1 Region: 148-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-97
Family Protein kinases, catalytic subunit 0.0000000000357
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-24
Family Pleckstrin-homology domain (PH domain) 0.000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4ADD6
Sequence length 482
Comment (tr|M4ADD6|M4ADD6_XIPMA) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS01030073} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MDEVTVVKEGWLHKRGEYIKTWRPRYFILKSDGSFIGYKDKPEVSSDLSLPPLNNFSVAE
CQLMKTERPKPNTFVIRCLQWTTVIERTFHVETNSEREEWMQVIQTVANSLKSQQQDEEP
MEIKFGSPSDSSGAEEMEIAMCKSRSKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRIFTEDRARFYGAEIVSALEYLHSRNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKTLAPEGKALLAGLLKKDPKQRLGGGPDDAKDVMTHKFFALINWQDVIE
KKLIPPFKPQVTSETDTRYFDDEFTAQSITITPPDKYDSLDVEDSDQRTHFPQFSYSASI
RE
Download sequence
Identical sequences A0A087XMG3 A0A0S7HKU5 M4ADD6
ENSXMAP00000012480 ENSXMAP00000012480 XP_005808006.1.87360 XP_005808007.1.87360 XP_007562857.1.10163 XP_014866123.1.96476 XP_014915684.1.100837 XP_014915685.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]