SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AG99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AG99
Domain Number 1 Region: 217-468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.36e-50
Family Voltage-gated potassium channels 0.0015
Further Details:      
 
Domain Number 2 Region: 62-174
Classification Level Classification E-value
Superfamily POZ domain 2.62e-29
Family Tetramerization domain of potassium channels 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4AG99
Sequence length 516
Comment (tr|M4AG99|M4AG99_XIPMA) Potassium voltage-gated channel, subfamily G, member 4b {ECO:0000313|Ensembl:ENSXMAP00000013493} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MPIISNANHDFSTYSISSDDSSLDRFFTEIPETETLKGVYFQRAQLLREPQASFTVDHAV
QVLINVGGNRYAFPWSTLEQFPQSRLARLRSCTTPEEIARLCDDYDETCREFFFDRNPTA
FRVILNFLAAGKLRLLRELCAVSLHDELDYWGVDPGHMERCCRRRMITRVDEVAERRRKE
EEWRQKRMKLKKRPPQAEKGYRRLVSALREVMENPHSGLAGKIFACLSIIMVLVTVVSLC
ISTMPDLRDEENRGECSQKCRNMFVVESVCVAWFTLEFLLRFVNAPSKLAFARGPLNVID
AVAILPYYVSLVFDVGEEAQDEAAMGAGRGYLDKLSLILRLLRALRILYVMRLARHSLGL
QTLGVTMQRSMREFGLLLLFVCVAVALFSPLVHLAESELAPFAAAHPQHSFSSIPASYWW
AIISMTTVGYGDMVPRSVPGQMVALISILSGILIMAFPATSIFHTFSRSYQELKQEYERV
WKQERHEEMSDFSQEDFSSASKKKSDGLTSNATHRS
Download sequence
Identical sequences M4AG99
ENSXMAP00000013493 ENSXMAP00000013493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]