SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AI09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AI09
Domain Number 1 Region: 90-191
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.06e-31
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 34-77
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000759
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4AI09
Sequence length 236
Comment (tr|M4AI09|M4AI09_XIPMA) MORN repeat containing 3 {ECO:0000313|Ensembl:ENSXMAP00000014103} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MPIYKPFRKTLPPSVQKDKDSQKCGLRHTVYSVCGNEYTGEWLENQKHGNGIQVWKKAGA
IYHGEWKYGKRDGYGTYSVQIPETKEYTRKYCGQWKNGKKHGYGTYFFDSSAVYEGEWAD
DQHNGWGRMYYENGDIYEGEWLNHKNHGRGIIRFSNGNWYEGSWRDGKRNGDGKFYYSDK
GLLYEGFWVDGIAKCGTLVDVGRESAPSPPEFPFPKIQLVDMELVLREARAACQCH
Download sequence
Identical sequences M4AI09
ENSXMAP00000014103 ENSXMAP00000014103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]