SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AJ73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AJ73
Domain Number 1 Region: 10-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-63
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 291-365
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000363
Family Ubiquitin-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4AJ73
Sequence length 747
Comment (tr|M4AJ73|M4AJ73_XIPMA) Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta {ECO:0000313|Ensembl:ENSXMAP00000014517} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MNRVPLQQPQTCGPWELKERLGTGGFGNVTRWQNKDTEEQIALKQCRQELSERNKERWSL
EIQIMKRLDHVNVVAAREVPQGMQKLVATNDLPLLAMEYCQGGDLRKYLNVLENCCGMRE
GSILILLRDISSALTYLHSKRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQSSLC
TSFVGTLQYLAPELIERQKYTVSVDYWSFGTLVFECITGFRPFLPTWQPVPWHNKVRLKN
DNDIVVYENLSGDIRFSKNLPQPNNLNSLLSERLEKWLQLMLKWSPKERGKDPNNTPSDC
FHQLESILQLKLVHVLNMMSAKILIYAISDDETVANLQLRIEKDTNIPAANQELLLEAGL
VLEPNALASQSAVDYMEVDGRRTDYTLVFLFDCSSCTYEPQFSPRILPENIRFIQKDPRI
PLPYSHLRRTCGQVWHTIRSLKEDWQRLQQGQKAAIMSLLRHNSTLSKQKIEMVSMYQRL
TAKLDFFNTSLHIDMDKYNEQTATGIASEKLLSVWREMEQIALSCGQKAQVTELEEEMMK
LQPDIVDVQRQPWRSGETLDTLEGKAMELFRKLREKPRDQRIPGDGTEAARLMVQAVQFY
EKKLRDFYTVLSKTAMCRHRVMELLPKVEEVVQKLAESEQVLMGLQEKRQKELWDLLKIA
CSKVRSPVSGSPDGLRTPSSVPPLLTPRNSLQQQDESLVEESRTFEGRLQSLLHETIQES
ESSMEMLKEWTWLRGQEEESKSVSQAE
Download sequence
Identical sequences M4AJ73
ENSXMAP00000014517 ENSXMAP00000014517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]