SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AL93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AL93
Domain Number 1 Region: 180-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.71e-57
Family Voltage-gated potassium channels 0.00082
Further Details:      
 
Domain Number 2 Region: 39-143
Classification Level Classification E-value
Superfamily POZ domain 9.22e-33
Family Tetramerization domain of potassium channels 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4AL93
Sequence length 638
Comment (tr|M4AL93|M4AL93_XIPMA) Potassium voltage-gated channel subfamily D member 1 {ECO:0000313|Ensembl:ENSXMAP00000015237} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN=KCND1 OC=Poeciliinae; Xiphophorus.
Sequence
MAAGVATWLPFARAAAVGWLPLAKKTMPKPPVDNSSRSDEILYVNVSGVRFQTWKNTLDR
YPDTLLGSSEKEFFYNEDTQEYFFDRDPEMFRHILNFYRTGKLHYPRHECVQAFDEELAF
YGIVPEIIGDCCMEEYRDRKKENQERLAEDTEANEATDAPLPPHSTSRERLWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCRPPKGSVKDLPCGEKYQLAFFCMDTACVLIF
TFEYLMRLFAAPSRCKFMRSVMSVIDVVAIMPYYIGLVMPENEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTKGSTFTSIPAS
FWYTIVTMTTLGYGDMVPNTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KMRAQQKVRLARIRMAKKGTSNAFLQYKEDHTLGDRNSDSTALCVKNRSAFEHQHNHLLH
CLEKTTNHEFTDEMTYSELCMTESVGFRTSRSTSLSSQQGAQNNSTGCCPRRARRRAAMR
LANSTVSVSRGSVQELDTLQFKTTSIPPQTRSSLNAQPDNLKLNCGDQDFTAAIISIPTP
PANTPDESLPPTPTPVPGILRNTRATAYTHETVKISSL
Download sequence
Identical sequences M4AL93
ENSXMAP00000015237 XP_005815470.1.87360 ENSXMAP00000015237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]