SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AP23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AP23
Domain Number 1 Region: 189-420
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.23e-59
Family Voltage-gated potassium channels 0.00065
Further Details:      
 
Domain Number 2 Region: 34-142
Classification Level Classification E-value
Superfamily POZ domain 1.1e-31
Family Tetramerization domain of potassium channels 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4AP23
Sequence length 828
Comment (tr|M4AP23|M4AP23_XIPMA) Potassium voltage-gated channel, Shab-related subfamily, member 1 {ECO:0000313|Ensembl:ENSXMAP00000016218} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MEKSLDLNKAGSRSTSSLPPEPVDIIRSKSCYRRVRLNVGGLPHEVLWRTLDRLPRTRLG
KLRDCNSHDSLMEVCDDYNLEENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQE
LDYWGIDEIYLESCCQARYHQKKEQMNEELKREADNLKDRDGEEFDNTCCAEKRKKLWDL
LEKPSSSVAAKILAIISILFIVLSTIALSLNTLPELQGTDEFGQSTDNPQLAHVEAVCIA
WFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQI
FRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEED
TKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSE
FYKEQKRQEKALKRREALERAKRNGSIVSMNLKEAFARSAELMDVVVEKSERPHDNHLSP
SHWKWASKRAASETSSNRSFNAQEIGSPCKARDTSPQRLNVEKLEEMYSQMAKTQSQPNL
NAKDRGSRVSKQRDEIELGAIHDYGPSVLGAKDGVGDMKSLSSIDSYISCATDFQENPRY
PHSPAADIGLKESTRFTFGPVTVLSQHISKRIGHQIIGQHESVLSPGLKSSGPENTRRFL
FSGNSSKSLKGGCRSDGDSGPSPLSDSSVVSDQSLLSPEASVYTTASSRTPPKSPDSTAM
APTVFTFHDSSISKYIDADTDDDEHLRDITEASPSDRLLAGGSPKRSININYQRGTNHLE
AAQKMLGQNCYFPLEGIRGKAHENHIGPDPARRPKAERGRQNTLDKGL
Download sequence
Identical sequences M4AP23
ENSXMAP00000016218 ENSXMAP00000016218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]