SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AQ06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AQ06
Domain Number 1 Region: 180-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-55
Family Voltage-gated potassium channels 0.00079
Further Details:      
 
Domain Number 2 Region: 40-144
Classification Level Classification E-value
Superfamily POZ domain 1.1e-31
Family Tetramerization domain of potassium channels 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4AQ06
Sequence length 622
Comment (tr|M4AQ06|M4AQ06_XIPMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSXMAP00000016551} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MAAGVAAWLPFARAAAIGWMPVASTPMPIPPQDKRKAQDGLIILNVSGTKFQTWRTTLER
YPDTLLGSTERDFFFHEETSEYFFDRDPDIFRHILNFYRTGKLHYPRQECISAYDEELAF
FGIIPEIIGDCCYEEYKDRRRENAERLQDDEEMDMNNDVTPVNLTFREYLWRAFENPHTS
TLALVFYYVTGFFIAISVMANVVETVPCGTLPNRSKEMSCGDRYALAFFCLDTACVMIFT
VEYLLRLIAAPSRCKFMKSVMSVIDVVAIMPYYIGLVMTDNDQVSGAFVTLRVFRVFRIF
KFSRHSAGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSTATKFTSIPAAF
WYTIVTMTTLGYGDMVPKTIVGKVFGSICSLSGVLVIALPVPVIVSNFSRIYHQSQRAEK
RRAQRKTRLARIRAAKIRGTNAYMRYKQNGLLIDALEEASKEAGQALVGKAASPPFESQH
HHLLHCLEKTTNHEFVDEQTFQANCMEISVVNKSGSRTSSLSSSPHGLSSCCSRRHRKKS
SFSLPSTNNQELSTIQIRERPVSNSRSSLNAKLDETMPLKCDEAYISPSMVRLSAPVATS
SDDASTATTTYSQSNIVRVSAL
Download sequence
Identical sequences M4AQ06
ENSXMAP00000016551 ENSXMAP00000016551 XP_005796338.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]